PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG002632.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 387aa    MW: 43295.8 Da    PI: 5.4357
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG002632.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT++Ed +++  v+++G+g+W++++++ g+ R++k+c++rw +yl
      CCG002632.1 14 RGLWTADEDAKILAHVAKHGTGNWTAVPKKAGLQRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding38.23.2e-1268109245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++T++E+e ++++++  G++ W+ Ia+ ++ gRt++++k+ w+
      CCG002632.1  68 DNFTPQEEEMIIRLHAAIGSR-WSIIAQQLP-GRTDNDVKNCWN 109
                      68*******************.*********.*********887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-23564IPR009057Homeodomain-like
PROSITE profilePS5129423.993965IPR017930Myb domain
SuperFamilySSF466891.32E-2911108IPR009057Homeodomain-like
SMARTSM007175.1E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001671.14E-111761No hitNo description
Gene3DG3DSA:1.10.10.604.6E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129416.1166116IPR017930Myb domain
SMARTSM007171.7E-1266114IPR001005SANT/Myb domain
CDDcd001676.18E-969109No hitNo description
PfamPF002495.8E-1169109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MVRPPCCGKL NVKRGLWTAD EDAKILAHVA KHGTGNWTAV PKKAGLQRCG KSCRLRWTNY  60
LSPDLKHDNF TPQEEEMIIR LHAAIGSRWS IIAQQLPGRT DNDVKNCWNA RLRKKLSEMG  120
IDPVTHKPFS KILADYGNIG GLVKSGSRIG SLSRDLKSVF TLKPEQYNSI LPEGISNINS  180
HLMTRMVPRK MEPVQECFLN RFNNDSTNSN HSLDLLDQLQ SIKLVTEASS TCPEYQTMLV  240
PNPNYNILDE GSLSSSTCST EAHENLPTSF RWCDFLLEDQ FLPNDPQAEQ ENAAELSSKD  300
LTNQTQNVIV TSQGQNPNLM KPQCDQIVAE VNVGVNGTDL AVQDNIGFGD QVAPSSSQHS  360
SFVETIIDEE NKIFFDFPNL LEELFNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028677.10.0PREDICTED: transcription factor RAX2-like
TrEMBLB9IEI50.0B9IEI5_POPTR; Uncharacterized protein
STRINGPOPTR_0015s07900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-71MYB family protein